>noo you can’t just insert a GFP gene in a mouse embryo, let it grow and then surgically attach its skin to other mouse just to check if there’s skin cell growth on the other mouse
>noo you cant just insert a GFP gene in a mouse embryo, let it grow and then surgically attach its skin to other mouse just to check if there...
Like GloFish?
in some mexican flea market, I remember seeing a bunch of baby chickens painted in bright colors
BROLY MOUSE
I want naturally Green Hair/Fur.
That's so pretty. What the fuck.
Funny how no mammal is green.
And getting moldy shit in their fur does not count.
I've always wondered why mammals don't have pretty hair or skin colors like brids and reptiles , imagine if we xould have natural green hair
My theory is that birds have an extremely effective evasion tactic so they don't need camouflage
Mammals have no sense of style. The ones who do get bright colors still are ugly.
Reminder that tigers actually appear green to most of their prey because they lack the ability to see reds. Even tigers themselves don't know they are orange
tigers are so cool, man
one important role of color is sexual selection to look beautiful from other individuals of the same species.
Animals other than mammals are tetrachromats. And they had developed brightness for this purpose.
But mammals are basically dichromats, due to the long period of the nocturnal lives in their early stage where they hid themselves from dinosaurs. If a dog got green fur, it's no different to yellow fur to their eyes.
only primates regained an additional sense of color very recently to distinguish edible plants as trichromats.
*brightness -> colorfulness
>imagine if we xould have natural green hair
An anon once explained to me why mammals can't have green hair or fur. Something about the structure or hair/fur being unable to reflect light at the necessary wavelengths or some shit. I forget.
actually. Color green seems beneficial to avoid being hunted by birds in grasses.
(note that yellow or brown fur is sufficient to avoid attacks from the larger mammals, since they are almost all dichromat that can't distinguish the color yellow, red, and green.)
parabiosis ;-;
Grim
Imagine being a mammal model organism.
Is there really a gene that makes you green?
I haven't seen this particular meme, but it would seem that this was a scheme by a team where a machine produced a gene to make the mouse green so they could glean if the other mouse's skin would teem.
>Aequorea victoria_green_flourescent_protein_reference
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
brown mouse green mouse
brown green mouse
What's happening there ?
The opposite of separating conjoined twins.
>remove part of the skin of one mouse
>graft a second mouse to the first so that its skin covers the part that got removed from the first
>the wound heals
>remove the second mouse after things heal up
>the second mouse's skin now grows where the first part was removed
we already know skin grafts are possible, but I don't think they've done it in some kind of reverse conjoined twins surgery before. some evil mengele nazi shit if you ask me.
Did they squish those two mouses together and make a mint choccy boi?
Kek why is the mouse green?
Because it has been genetically modified with a protein that converts normally-outside-vision light to green light. Consequently, it also glows in the dark!
I guarantee you that it doesn’t, and that it actually fluoresces.
https://www.researchgate.net/publication/298420450_Differentiation_of_Apical_Bud_Cells_in_a_Newly_Developed_Apical_Bud_Transplantation_Model_Using_GFP_Transgenic_Mice_as_Donor
Oh well would you look at that, it doesn’t produce light.
>umm umm uuuh ACKSHUALLY green fluorescent protein FLUORESCES uh huh huh
wow, no shit? you are very smart
for a nolabz moronmonkey
lmao